PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_007281-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 306aa    MW: 34233.1 Da    PI: 4.5188
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_007281-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l++ +   G  +W+++++  g++R++k+c++rw +yl
  AHYPO_007281-RA 14 KGPWTAEEDKKLINFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.42.5e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +  E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
  AHYPO_007281-RA  71 SDSEEQLVIDLHARLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      788***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.027961IPR017930Myb domain
SuperFamilySSF466892.86E-2611108IPR009057Homeodomain-like
SMARTSM007178.5E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-141461IPR001005SANT/Myb domain
CDDcd001671.17E-91661No hitNo description
PROSITE profilePS5129426.64862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2463117IPR009057Homeodomain-like
SMARTSM007178.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.5E-1471111IPR001005SANT/Myb domain
CDDcd001676.33E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLINFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SDSEEQLVID LHARLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPLN KDQPPNTQNI